PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G088100.1
Common NameB456_004G088100, LOC105790808
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family HB-other
Protein Properties Length: 1010aa    MW: 110968 Da    PI: 9.31
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G088100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.24.9e-0769125157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         +r+R  ++++ ++ ++++F  +  ++++e +e++++ g+t +qV+ +F  +R++ +k
  Gorai.004G088100.1  69 KRPRDLLNPKAVKYMQAVFSIKDAITKKESREISAQFGVTVTQVRDFFNSQRTRVRK 125
                         799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.51166126IPR001356Homeobox domain
SuperFamilySSF466899.41E-768131IPR009057Homeodomain-like
SMARTSM003894.9E-568130IPR001356Homeobox domain
PfamPF000462.0E-469125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-769136IPR009057Homeodomain-like
CDDcd000861.68E-569126No hitNo description
Gene3DG3DSA:1.20.930.104.0E-5226318IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476763.4E-5227317IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1010 aa     Download sequence    Send to blast
MDVLKENLAE LEIGSTVESI QKFIEIQREL FHSQIDQLQN VVVTQCKLTG VNPLAQEMAA  60
GALSIKIGKR PRDLLNPKAV KYMQAVFSIK DAITKKESRE ISAQFGVTVT QVRDFFNSQR  120
TRVRKQVRLS REKALRSNAC KEAEDGVLPT GSEAVIPVEP VPLNSVGPVS SEEAPSCSTQ  180
DDSLTGIDEL DKHFVENIFS KMHKEETFSG QVKLMEWILQ IQNPSVLYWF LNKGGVMILA  240
TWLSQAAVEE QTTVVLIILK VLSHLPLQKA LPEHMSAILQ SVNKLCLYRF SDISNRARLL  300
ISRWSKMFAR SQAAKKPNGL RSSTETQNEM LLKQSISEIM GHGSWQSNVY NSEGTLATSN  360
VRKESPQVLK LLPASMDDSA KKNLLGVSSS HSRERRRVQL VEQPGQKVAG KNSQTTRPVP  420
ISQSRPMSAD DIQKAKMRAL YMQSKHGKTG SSSNGMNEVK SEGLNKSSPS KASFSRPVSK  480
VSSHPAEEQK KPVVLPPKTS SRVETSLDPK QPVASKESPW EKCQKVKIPW HIPPEVKIND  540
LWSVGAGESS KEVHVQKNRN RRERETFYYT NQEIPSNPKE PWDREMDHDD SLTPEIPTEQ  600
PPDNETETQV THGEHVNGAA TLEPSTSQTG GAVSAEPDLE LLAVLLKNPA LVFALTSGQA  660
GNLTSEETVK LLDMIKAGGA DTGNNVEEKV EVSLPSPTPS TNPGTSGWRP EAVRNPFSQH  720
SQMGNRVAQA SVGVVTPIPV AERLSATGMA APQQEANGLS LAQQLAAAMA ELLPQSNATT  780
LDKRHSPNVA FSNHGHPSNL PASDIALTMK NPSLVNSLTN SSAAAGPSMW VETMNVKTAA  840
ISMAPHIPEK VHTSFSPSPL MPTLTQRQTP AQLQPQVPHA SDPYSTRPPV GNLGPMPDPW  900
RGRQSLGSNL HSQANQNNYN ASSFGGSMHP QLRTDPPREG KEYAGNEGFE SWSPDNSPNR  960
SSEYVAGRNY MEPRMNSGWN YRADRPSWQG NSSGYRDPNR QGNRWRDRR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474033.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0D2QUG60.0A0A0D2QUG6_G
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-176HB-other family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]